PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06441g01026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 305aa    MW: 33992.2 Da    PI: 6.5907
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06441g01026.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-18233266134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               C +C  tkTp+WR gp g+ktLCnaCG++y+k +
  Niben101Scf06441g01026.1 233 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKKGR 266
                               99******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.2E-683304IPR016679Transcription factor, GATA, plant
SMARTSM004012.9E-15227277IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.279227263IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-15231265IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.04E-15231290No hitNo description
CDDcd002021.26E-13232279No hitNo description
PfamPF003207.0E-16233267IPR000679Zinc finger, GATA-type
PROSITE patternPS003440233258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGSNLVDEID CASFFDHMDD LIESSPENEC GDLDSTECKN FPSICNDPLP DSDSLFFGSF  60
RNSPSDFSAE LLVPYEDIVQ LEWLSTFVED SFSCGGLTMG KEHFPVNKEP SHSKFLSSSP  120
VSVLESRSSS SSSSGAGKTT PPLSPCHRGT QRARTKRPRP AAFNPWPVSQ LMSPTSSFTE  180
IHQQFVAPED TLESDNFGES PMKKKKRIKF SIPLAPVDTN QNYQRALQTV RKCMHCEITK  240
TPQWRAGPMG PKTLCNACGV RYKKGRLFPE YRPAAAPTFV PTLHSNSHKK VLEMRSNFPE  300
DTHDK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155159KRPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605437.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016465627.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016465628.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLM1CLQ91e-152M1CLQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000701341e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23452358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-42GATA transcription factor 9